PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00018.1.g00390.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 852aa    MW: 92723.4 Da    PI: 6.4679
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00018.1.g00390.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.1e-182683457
                                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                                      ++t+eq+e+Le+++ ++++ps  +r+++ +++    +++ +q+kvWFqNrR +ek+
  Zpz_sc00018.1.g00390.1.sm.mkhc 26 YVRYTPEQVEALERVYSECPKPSSLRRQQIIRECpilsNIEPKQIKVWFQNRRCREKQ 83
                                    6789****************************************************97 PP

2START175.53.3e-551743812204
                                     HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEE CS
                           START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakae 80 
                                     +aee+++e+++ka+ ++  Wv+++ +++g++++ +++ s+++sg a+ra+g+v  +++  v+e+l+d++ W ++++ ++
  Zpz_sc00018.1.g00390.1.sm.mkhc 174 IAEETLAEFLSKATGTAVDWVQMVGMKPGPDSIGIIAVSHNCSGVAARACGLVSLEPP-KVAEILKDRPSWYRDCRCVD 251
                                     7899******************************************************.8888888888********** PP

                                     EEEEECTT..EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEE CS
                           START  81 tlevissg..galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgil 153
                                     +l vi +g  g+++l++++++a+++l++ Rdf+++Ry+  l++g++vi+++S+++ +  p+   ++++vRae+lpSg+l
  Zpz_sc00018.1.g00390.1.sm.mkhc 252 VLHVIPTGngGTIELIYMQTYAPTTLAApRDFWTLRYTSGLEDGSLVICERSLTQSTGGPSgpnTPNFVRAEVLPSGYL 330
                                     **************************999****************************9999999*************** PP

                                     EEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
                           START 154 iepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                                     i+p+++g+s +++v+hvdl++++++++lr+l++s  + ++kt+ a+l++ +
  Zpz_sc00018.1.g00390.1.sm.mkhc 331 IRPCEGGGSMIHIVDHVDLDAWSVPEVLRPLYESPKILAQKTTIAALRHIR 381
                                     **********************************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-181183IPR009057Homeodomain-like
PROSITE profilePS5007115.2562084IPR001356Homeobox domain
SMARTSM003893.8E-152288IPR001356Homeobox domain
SuperFamilySSF466891.37E-162487IPR009057Homeodomain-like
CDDcd000864.88E-162585No hitNo description
PfamPF000465.4E-162683IPR001356Homeobox domain
CDDcd146861.81E-677116No hitNo description
PROSITE profilePS5084826.907164364IPR002913START domain
CDDcd088751.77E-69168384No hitNo description
Gene3DG3DSA:3.30.530.201.2E-23173356IPR023393START-like domain
SMARTSM002342.3E-48173383IPR002913START domain
SuperFamilySSF559611.19E-38174384No hitNo description
PfamPF018529.2E-53174381IPR002913START domain
PfamPF086701.3E-50709851IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009855Biological Processdetermination of bilateral symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 852 aa     Download sequence    Send to blast
MVAAGGGKDR SSPGGGGAPQ VDTGKYVRYT PEQVEALERV YSECPKPSSL RRQQIIRECP  60
ILSNIEPKQI KVWFQNRRCR EKQRKEASRL QTVNRKLTAM NKLLMEENDR LQKQVSRLVY  120
ENGYMKQQLH NPSVATTDTS CESVVTSGQH HQQQNSAAPR PPRDANNPAG LLTIAEETLA  180
EFLSKATGTA VDWVQMVGMK PGPDSIGIIA VSHNCSGVAA RACGLVSLEP PKVAEILKDR  240
PSWYRDCRCV DVLHVIPTGN GGTIELIYMQ TYAPTTLAAP RDFWTLRYTS GLEDGSLVIC  300
ERSLTQSTGG PSGPNTPNFV RAEVLPSGYL IRPCEGGGSM IHIVDHVDLD AWSVPEVLRP  360
LYESPKILAQ KTTIAALRHI RQIAHESSGE MPYVGGRQPA VLRTFSQRLS RSFNDAVNGF  420
PDDGWSLLSS DGAEDVTIAI NSFPNKLVGS HVNSSHLFSA IGGGILCAKA SMLLQNVPPA  480
LLVRFLREHR SEWADPGVDA YSAAALRASP YAVPGLQASG FMGSQVILPL AHTLEHEEFL  540
EVIRLEGHSF CHDEVVLSRD MYLLQLCSGV DENAAGACAQ LVFAPIDESF ADDAPLLPSG  600
FCVIPLDAKT DPPSGTRTLD LASTLEVGSG GTTRASSDAS STSNTRSVLT IAFQFSYENH  660
LRESIAAMAR QYVRTVVASV QRVAMAIAPS RLGGQLEVKQ TPGSPEAQTL ARWIGRSYRF  720
HTGAELLRTE TQCTDSSLKA LWQHSDSIMC CSLKAAPVFT FANQAGLDML ETTLIALQDI  780
PLEKILDDDG RKALCSEHPK LMQQGFAYLP GGVCVSSMGR PVSYEQAVAW KVLSDDDTPH  840
CLAFMFVNWS FV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1032840.0AK103284.1 Oryza sativa Japonica Group cDNA clone:J033124M18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982339.10.0PREDICTED: homeobox-leucine zipper protein HOX32
SwissprotQ6AST10.0HOX32_ORYSJ; Homeobox-leucine zipper protein HOX32
TrEMBLK4A5S40.0K4A5S4_SETIT; Uncharacterized protein
STRINGSi034228m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34710.10.0HD-ZIP family protein